PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001148.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 353aa    MW: 38668.3 Da    PI: 7.5882
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001148.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEde+l ++++ +G g+W++ ++  g+ R++k+c++rw +yl
      Pbr001148.1 14 RGKWTAEEDEILTKYIHAHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding55.99.8e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +v++++ lG++ W++Ia++++ gRt++ +k++w+++l
      Pbr001148.1  67 RGNFTAEEEETIVKLHRALGNR-WSLIAAHLP-GRTDNGIKNYWNSHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.233961IPR017930Myb domain
SuperFamilySSF466895.87E-2911108IPR009057Homeodomain-like
SMARTSM007173.4E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001674.50E-101661No hitNo description
PROSITE profilePS5129425.95862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2565116IPR009057Homeodomain-like
SMARTSM007178.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1567112IPR001005SANT/Myb domain
CDDcd001671.06E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGRAPCCEKL GLKRGKWTAE EDEILTKYIH AHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRAELKRGNF TAEEEETIVK LHRALGNRWS LIAAHLPGRT DNGIKNYWNS HLSRKIYSFI  120
KLGNEHLPSI LNDVKKITSC NKRCKGARAS RSTMNNKSKN KNLATFNSRK SEANPQLGNP  180
SLPTGTIINL GQVGNEASNL RGLESWDPIN NRDGEVIGML GMQSSCLDGA EMINLDPCGE  240
QKKSAQLCLG KKENNITSSS TAIYGDNDCE TEVLGTSCEC VDTMDQNNNI FEIEERRSTG  300
IWSSSNAAES GGGGGGGELY SFASSMNSGF DDEWLNWGWA GGGLQCHNGE LE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-251211625128MYB TRANSFORMING PROTEIN
1mse_C5e-25121162105C-Myb DNA-Binding Domain
1msf_C5e-25121162105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBMTransfer from AT5G49330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009347775.10.0PREDICTED: myb-related protein P-like
TrEMBLM5XBH21e-123M5XBH2_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.11e-74myb domain protein 111